HORDB

ID: hor000172
Uniprot ID: A0A8J5NBH7
Protein name: CHH precursor-related peptide
Gene name: ChhB-L2
Organism: Homarus americanus (American lobster)
Family: Arthropod CHH/MIH/GIH/VIH hormone family
Source: animal
Expression: sinus gland
Disease: NA
Comments: NA
Taxonomy: Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: RSVEGVSRMEKLLSSISPSSTPLGFLSQDHSVN
Length: 33
Propeptide: MKNVFSYYEIVVVPLSLSLSFLHQRNFGVSPSQLCLVVVMVASLGTSGVGGRSVEGVSRMEKLLSSISPSSTPLGFLSQDHSVNKRQVFDQACKGVYDRNLFKKLNRVCEDCYNLYRKPFIVTTCRENCYSNRVFRQCLDDLLMIDVIDEYVSNVQMVGK
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000172_AF2.pdb

hor000172_ESM.pdb

Mass:	411689	Formula:	C151H250N44O52S
Absent amino acids:	ACWY	Common amino acids:	S
pI:	7.55	Basic residues:	4
Polar residues:	13	Hydrophobic residues:	9
Hydrophobicity:	-25.76	Boman Index:	-6381
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	85.45
Instability Index:	6877.27	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 18304551
Title: Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus